Gridinsoft Logo

Schwab.com Reputation Review

June 26, 2026 at 9:04 PM
Checked by Website Reputation Checker
Table of Contents
Danger Zone
Risky Territory
Caution Advised
Trusted but Verify
Safe & Secure

Schwab → Safety Check

First checked September 15, 2025 at 4:12 PM
Website content and technical signals analyzed
Method: automated checks.
Likely Safe Strong trust evidence leads the assessment: 33.3-year domain history, public traffic rank, and business infrastructure. Mixed review signals still deserve a quick check.
Trust signal radar Normalized trust signals for schwab.com Domain Maturity: 12145 days Domain Maturity Warning Cleanliness: 0 detections Warning Cleanliness Safety Level: 1 negative tag, 1 warning signal Safety Level Positive Signals: 6 positive signals Positive Signals Popularity: Tranco rank 2,008 Popularity Trust Zone: .com Trust Zone Operational Signals: 15 detected services Operational Signals Location Credibility: Hosting country US Location Credibility
Figure 1. Trust signal radar for schwab.com. Larger shaded area indicates stronger trust signals.

How we scored schwab.com

On-page mentions:
Financial Service, Quick Payment, Forex, Financial Tools
Tech signals:
Drupal Platform, Corporate Registration, Strong Community Presence
Positive signals:
  • no major malware/phishing detections
  • verified business services
  • business infrastructure
  • popular site
  • a verified profile linked to this domainYouTubeCharles Schwab544,000 subscribers · 19.8 years
  • a long-term domain history (33.3 years)
  • a long-term SSL certificate (13 months)
  • strong independent trust
Negative signals:
  • low third-party review ratings
  • a low user rating from 782 reviews
Context signals:
  • financial-service content that requires stronger independent verification
Review sentiment:
Unfavorable
1.6 / 5 ★★☆☆☆
Based on analysis of 782 reviews from SmartCustomer and other public sources.
Last checked June 26, 2026 at 9:04 PM by Gridinsoft Trust Model v2.4.9
This domain was registered 33 years ago through the company MarkMonitor Inc. and ownership information is not publicly available.

About schwab.com

We reviewed schwab.com and found a strong trust profile with some mixed public feedback. Current checks lean more legitimate than deceptive, and the current trust score is 95/100. Key signals include no major malware/phishing detections, verified business services, and business infrastructure. Public review signals are mixed across third-party sources, but the broader legitimacy and infrastructure signals remain strong. If you plan to use paid services through this site, review recent customer feedback, pricing terms, and support expectations before proceeding.

Figure 2. Website screenshot for Schwab.com. 2026-06-27 00:04:24

FAQ

Is schwab.com safe?

Based on current analysis, schwab.com leans generally safe with a 95/100 trust score. Key trust factors include 33.3-year domain history, public traffic rank, and business infrastructure; mixed review signals should still be checked.

Why does schwab.com look trustworthy?

Key factors include registrar information (MarkMonitor Inc.), hosting in US, a domain age of 33.3 years, and presence in public traffic rankings. Major malware and phishing engines did not report active blacklist detections at the time of review, but reputation-related warning signals were still present. The trust score blends security detections, domain and infrastructure signals, on-page behavior patterns, and public review history when available. The overall assessment remains mixed because third-party reputation sources do not point to a fully consistent trust profile.

Schwab Digital Footprints

A structured view of the site's detected themes, page signals, and related online footprint elements.

Financial Service

This site presents financial-service content, such as investment, brokerage, advisory, or wealth-management offerings.

Quick Payment
Registration Form

This website implements data collection forms that may request personal information including names, email addresses, phone numbers, or other sensitive details. You should verify its legitimacy and review privacy policies before submitting personal data.

Forex

schwab.com presents forex-related trading content, such as currency markets, broker services, exchange-rate tools, or leveraged trading features.

Cookie Consent

This site implements a cookie-consent interface for managing tracking and data-collection preferences.

Financial Tools
Drupal Platform

Our analyzer determines that this website is using Drupal CMS. This highly customizable platform powers approximately 1.2% of websites.

Social Media Links

The presence of social media links on the website indicates that it references social media accounts. This signal alone does not confirm ownership or authenticity of those profiles.

Long Term SSL Certificate

The SSL certificate for this site is valid for more than 6 months, indicating a long-term commitment to security and trust.

Popular Site

This site shows elevated traffic signals relative to similar domains; this is generally positive but does not by itself prove legitimacy.

Established Domain

schwab.com has maintained active domain presence over time, indicating operational continuity.

Verified YouTube Channel

Ownership verification confirms that this site controls the YouTube channel Charles Schwab (@charlesschwab) (544,000 subscribers, 714 videos, 18,624,033 total views, since 2006, country: US).

Corporate Registration

This domain is registered through a corporate-focused registrar, MarkMonitor Inc., commonly used by established organizations for managed domain protection and portfolio control.

Verified Business Services

The domain schwab.com publishes TXT verification records for multiple third-party business platforms. This indicates that the domain has been connected to those services at the DNS level.

Business Infrastructure

This domain is configured for several service layers, such as email delivery, platform verification, or security tooling. This reflects a broader operational setup than a minimal single-purpose deployment.

Strong Community Presence

This site has ownership-verified social or community presence with substantial audience reach.

Color Guide
  • Requires special attention Marks high-risk findings that should be reviewed first.
  • Exercise caution Highlights areas involving user data, payments, or permissions.
  • Positive indicators Shows trust signals that support the site's reliability.
  • Neutral General context that does not increase or reduce risk on its own.

Domain Information

Created April 7, 1993 at 4:00 AM Updated: March 7, 2026 at 9:40 AM · Expires: April 8, 2027 at 4:00 AM
Domain Age 33.3 years
Registrant US (United States)
Registrar MarkMonitor Inc. IANA ID: 292
Abuse Email [email protected]
Domain Status Client Delete Prohibited · Client Transfer Prohibited · Client Update Prohibited +3 more · DNSSEC: UNSIGNED
Top Level Domain .com Generic TLD

Technical Details

HTTP status 301
IP Address 162.93.215.103
Hosting Provider AS6949 Charles Schwab & Co., Inc. Los Angeles, California, US
SSL Certificate DigiCert Global G2 TLS RSA SHA256 2020 CA1 TLS 1.3 · Valid for: 13 months · from August 18, 2025 at 12:00 AM · to September 10, 2026 at 11:59 PM
Name Servers a8-64.akam.net
a9-65.akam.net
np1.schwab.com
np2.schwab.com

Content Analysis

Website title Charles Schwab | A Modern Approach to Investing and Retirement Planning | Charles Schwab
Website description Charles Schwab offers investment products and services, including brokerage and retirement accounts, online trading and more.
Primary Language
Profile
Charles Schwab · 544,000 subscribers · 19.8 years
Mentioned hosts (37)
twitter.com www.stockbrokers.com events.launchdarkly.com workplacefinancialservices.schwab.com international.schwab.com s.go-mpulse.net tags.tiqcdn.com tsdrs.schwab.com www.schwab.co.uk sws-gateway-nr.schwab.com www.sipc.org www.glancecdn.net app.launchdarkly.com www.schwab.com a14738960062.cdn.optimizely.com and 22 more

Security Analysis

Detection Signatures These signatures are used to generate the security fingerprint below.
Financial Service Quick Payment Registration Form Forex Cookie Consent Financial Tools Drupal Platform
Verified Services This domain has been verified by the following legitimate services and organizations, confirming authentic ownership and proper email security configuration.
Apple Apple Inc. services verification. Atlassian Software development tools (Jira, Confluence). Cisco Control Hub Cisco device management platform. Dell TECHNOLOGIES Technology solutions and services verification. Docker Containerization platform verification. DocuSign Electronic signature and agreement platform. Facebook Social media platform by Meta. Figma Collaborative interface design tool. Google Verification Domain ownership verified by Google. Jamf Apple device management solution. LogMeIn Remote access and support software. Microsoft 365 Microsoft cloud productivity suite (Office, email, etc.). MongoDB NoSQL database platform. Salesforce Marketing Cloud Marketing automation by Salesforce. VMware Cloud Cloud computing and virtualization.
Security Fingerprint Unique identifier based on site analysis

Are You the Owner?

If you own Schwab.com and want to challenge the trust score, please submit a review request via portal.gridinsoft.com. There you can claim your profile and add verified company/contact details. If you cannot access the portal, email legal(at)gridinsoft.com with proof of legitimacy and contact details. We never charge website owners for reviews or reconsideration requests. For more information, please review our Disclaimer.

Leave a review

Share your real experience with schwab.com. Is it a trustworthy site, or did you encounter any issues? The more detail you provide, the more helpful your review is for others!

Publication Tip

- Your feedback helps us improve our security scores.
- Detailed reviews describing your real-life experience have a much higher chance of being published.
- Your email remains confidential.

Gridinsoft Portal
Signed in via Gridinsoft Portal · View profile
Your score for schwab.com
95
points /100
The score is based on a 1-100 scale, with 100 being the most reputable.
Check another website
Verify the security of domains and services based on 10M+ real websites.
Is This Your Website?
Think your website was scored unfairly? Request a reevaluation and our team will take another look.
Flag for Reevaluation
Have you had a personal experience with Schwab.com?
Share your thoughts and rate it to help others make informed decisions!
Is This Your Website?
Think your website was scored unfairly? Request a reevaluation and our team will take another look.
Flag for Reevaluation
Have you had a personal experience with Schwab.com?
Share your thoughts and rate it to help others make informed decisions!